Thymosin Beta-4 is the full 43-amino acid form of the naturally occurring actin-sequestering peptide found abundantly in platelets, macrophages, and most nucleated cells. Research has examined its roles in wound healing, cardiac repair, inflammation modulation, and neurological recovery. It serves as the parent compound to the TB-500 fragment, with a broader research literature base.
Thymosin Beta-4 is the full 43-amino acid form of the naturally occurring actin-sequestering peptide found abundantly in platelets, macrophages, and most nucleated cells. Research has examined its roles in wound healing, cardiac repair, inflammation modulation, and neurological recovery. It serves as the parent compound to the TB-500 fragment, with a broader research literature base.
Thymosin Beta-4 (Thymosin Beta-4 Full Sequence) is supplied strictly as a reference material for in vitro and preclinical investigation. All characterization data described here is drawn from peer-reviewed literature and laboratory analysis; nothing herein constitutes a claim of clinical effect in humans.
The following domains summarize directions explored across published studies and laboratory models. Each reflects observations reported in rodent models, in vitro systems, or the peer-reviewed record.
Thymosin Beta-4 has been extensively studied in cardiac injury models. Research has documented its ability to activate epicardial progenitor cells, stimulate cardiomyocyte survival, and promote neovascularization after myocardial infarction in animal models.
As the parent peptide of TB-500, Thymosin Beta-4 contains the full actin-binding domain and additional regulatory sequences. Research has documented comprehensive effects on cell migration, ECM remodeling, and wound closure in rodent models.
Research has examined Thymosin Beta-4 in spinal cord injury and traumatic brain injury models, with studies documenting oligodendrocyte differentiation, axonal outgrowth, and neuroprotective effects in rodent subjects.
Studies have documented Thymosin Beta-4's anti-inflammatory properties, including downregulation of NF-κB and modulation of cytokine profiles in macrophage and endothelial cell culture models.
Mechanistic steps below are hypothesized from in vitro assays and animal-model data reported in the literature. They describe biochemical interactions observed under controlled experimental conditions.
The LKKTET sequence within Thymosin Beta-4 binds G-actin monomers with nanomolar affinity, regulating cytoskeletal dynamics and enabling coordinated cell migration in wound healing and tissue repair models.
Research has documented Thymosin Beta-4's activation of integrin-linked kinase (ILK), triggering PI3K/Akt and downstream pro-survival signaling in cardiomyocytes, endothelial cells, and neural progenitor cells.
Studies have shown Thymosin Beta-4 activates quiescent epicardial cells post-cardiac injury, promoting their differentiation into vascular smooth muscle cells and contributing to post-infarction neovascularization in mouse models.
Thymosin Beta-4 has been shown to inhibit NF-κB nuclear translocation in inflammatory cell models, reducing TNF-α, IL-1β, and IL-6 production — an effect studied in both systemic and local inflammatory models.
| Amino Acid Sequence | SDKPDMAEIEKFDKSKLKKTETEQEKNPLPSKETIEQEKQAGES |
|---|---|
| Molecular Weight | 4,963.5 g/mol |
| Molecular Formula | C₂₁₂H₃₅₀N₅₆O₇₈S₅ |
| CAS Number | 77591-33-4 |
| Storage | −20°C long-term, 4°C short-term up to 4 weeks |
The following peer-reviewed references informed the research summaries on this page. Citations are provided for scientific context only.
This product is intended strictly for laboratory research purposes only. It is not a drug, food, cosmetic, or dietary supplement and is not intended to diagnose, treat, cure, or prevent any disease. It is not for human or animal consumption. All information presented is derived from published scientific literature and is provided for educational reference only. By purchasing, the buyer affirms they are a qualified researcher or institution and assume full responsibility for the safe and lawful handling of this material.